PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_25464_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 263aa    MW: 30185.6 Da    PI: 5.5276
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_25464_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.6e-1857110356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++t +q+++Le+ Fe ++++  e++++LA++lgL+ rq+ vWFqNrRa+ k
  Neem_25464_f_1  57 KKRRLTLQQVKALEKNFEVDNKLEPERKAKLAEELGLQPRQIAVWFQNRRARLK 110
                     56689***********************************************98 PP

2HD-ZIP_I/II1215.9e-3956148193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrl+ +qvk+LE++Fe ++kLeperK++la+eLglqprq+avWFqnrRAR k+k+lE+dy  Lk++ydalk + ++Le+e+e+L+++++e
  Neem_25464_f_1  56 EKKRRLTLQQVKALEKNFEVDNKLEPERKAKLAEELGLQPRQIAVWFQNRRARLKSKELERDYGLLKANYDALKLDYNTLEQENETLAAKIRE 148
                     69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.01E-1847113IPR009057Homeodomain-like
PROSITE profilePS5007117.76752112IPR001356Homeobox domain
SMARTSM003893.8E-1755116IPR001356Homeobox domain
CDDcd000867.95E-1557113No hitNo description
PfamPF000461.5E-1557110IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-1959118IPR009057Homeodomain-like
PRINTSPR000314.0E-68392IPR000047Helix-turn-helix motif
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PRINTSPR000314.0E-692108IPR000047Helix-turn-helix motif
PfamPF021831.8E-14112153IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MKRFSSSDSL DALFSVYQSK DKKSPKNNQI YSREFQAMID SLEEEDYREE GSQAPEKKRR  60
LTLQQVKALE KNFEVDNKLE PERKAKLAEE LGLQPRQIAV WFQNRRARLK SKELERDYGL  120
LKANYDALKL DYNTLEQENE TLAAKIRELK AKLCKENVDS SHAVKEEAPV SEQSKNQDLC  180
DNANAPLLIS PASSSSLFTG SSSSSHSPIN WVQFSDSRRI PSGAYQQPHF LKVEEQSWFN  240
SEDSCNFLSV DQAPTLQWYF TGQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006472553.11e-140PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform X1
TrEMBLA0A067GZZ61e-140A0A067GZZ6_CITSI; Uncharacterized protein
STRINGPOPTR_0002s10080.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.22e-50homeobox protein 5